Structure of PDB 4xrs Chain G Binding Site BS01

Receptor Information
>4xrs Chain G (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNR
RSKFKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xrs DNA-dependent formation of transcription factor pairs alters their binding specificity.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		K131 R133 T134 Y136 I175 N179
Binding residue
(residue number reindexed from 1)		K1 R3 T4 Y6 I45 N49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xrs, PDBe:4xrs, PDBj:4xrs
PDBsum4xrs
PubMed26550823
UniProtO60479|DLX3_HUMAN Homeobox protein DLX-3 (Gene Name=DLX3)

[Back to BioLiP]