Structure of PDB 4xqn Chain G Binding Site BS01

Receptor Information
>4xqn Chain G (length=98) Species: 93062 (Staphylococcus aureus subsp. aureus COL) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELS
QLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xqn Conformational features of theStaphylococcus aureusAgrA-promoter interactions rationalize quorum-sensing triggered gene expression.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		L192 D193 D194
Binding residue
(residue number reindexed from 1)		L52 D53 D54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0003677 DNA binding

View graph for
Molecular Function
External links
PDB RCSB:4xqn, PDBe:4xqn, PDBj:4xqn
PDBsum4xqn
PubMed28955870
UniProtQ5HEG2|AGRA_STAAC Accessory gene regulator A (Gene Name=agrA)

[Back to BioLiP]