Structure of PDB 4xoa Chain G Binding Site BS01

Receptor Information
>4xoa Chain G (length=279) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPE
TITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTD
KPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYA
NNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGT
TADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSL
GLTANYARTGGQVTAGNVQSIIGVTFVYQ
Ligand information
>4xoa Chain H (length=14) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADVTITVNGKVVAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xoa Catch-bond mechanism of the bacterial adhesin FimH.
Resolution2.541 Å
Binding residue
(original residue number in PDB)
V163 A165 R166 D167 V168 V170 T171 L172 D174 Y175 Y256 V263 A265 G266 V268 Q269 S270 I271 I272 G273 V274 F276
Binding residue
(residue number reindexed from 1)
V163 A165 R166 D167 V168 V170 T171 L172 D174 Y175 Y256 V263 A265 G266 V268 Q269 S270 I271 I272 G273 V274 F276
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005537 D-mannose binding
Biological Process
GO:0007155 cell adhesion
GO:0007638 mechanosensory behavior
GO:0031589 cell-substrate adhesion
GO:0043709 cell adhesion involved in single-species biofilm formation
Cellular Component
GO:0009289 pilus
GO:0009419 pilus tip
GO:0033644 host cell membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4xoa, PDBe:4xoa, PDBj:4xoa
PDBsum4xoa
PubMed26948702
UniProtP08191|FIMH_ECOLI Type 1 fimbrin D-mannose specific adhesin (Gene Name=fimH)

[Back to BioLiP]