Structure of PDB 4xgr Chain G Binding Site BS01

Receptor Information
>4xgr Chain G (length=128) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARF
GEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKAGLNYGDCFSY
GLAKISGQPLLFKGEDFQHTDIATVALP
Ligand information
>4xgr Chain H (length=24) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DELAAIRHRCAALPVVDNRSAEAI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xgr Structural and functional studies of the Mycobacterium tuberculosis VapBC30 toxin-antitoxin system: implications for the design of novel antimicrobial peptides
Resolution2.7 Å
Binding residue
(original residue number in PDB)		M11 S13 D14 E22 E26 V44 A47 R48 F49 E56 W60 R63
Binding residue
(residue number reindexed from 1)		M12 S14 D15 E23 E27 V45 A48 R49 F50 E57 W61 R64
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004518 nuclease activity
GO:0004540 RNA nuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0045926 negative regulation of growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xgr, PDBe:4xgr, PDBj:4xgr
PDBsum4xgr
PubMed26150422
UniProtP9WF77|VPC30_MYCTU Ribonuclease VapC30 (Gene Name=vapC30)

[Back to BioLiP]