Structure of PDB 4why Chain G Binding Site BS01

Receptor Information
>4why Chain G (length=199) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLQESGGGLVQPGRSLKLSCAASGFTFSDSYLAWVRQAPTKGLEWVASIT
NSGGRFYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTRMDYW
GQGTTVTVSSAETTAPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSSGVH
TFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4why Structural flexibility of a conserved antigenic region in hepatitis C virus glycoprotein e2 recognized by broadly neutralizing antibodies.
Resolution2.62 Å
Binding residue
(original residue number in PDB)
Y33 R57 F58 Y59
Binding residue
(residue number reindexed from 1)
Y31 R55 F56 Y57
External links