Structure of PDB 4wan Chain G Binding Site BS01

Receptor Information

>4wan Chain G (length=116) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVK
ELPPGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSPEGQNDLK
RGQLRELAELNGTLRE

Ligand information

>4wan Chain H (length=9) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

auacuaaca

.........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wan Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	G166 L169 G170 P171 R172 G173 L176 K186 I189 R190 K196 P205 G247 Q248 N249 K252 R253 Q255 L256 R257 L259 A260 R267
Binding residue (residue number reindexed from 1)	G20 L23 G24 P25 R26 G27 L30 K40 I43 R44 K50 P53 G95 Q96 N97 K100 R101 Q103 L104 R105 L107 A108 R115

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:4wan, PDBe:4wan, PDBj:4wan
PDBsum	4wan
PubMed	25587180
UniProt	Q12186\|BBP_YEAST Branchpoint-bridging protein (Gene Name=MSL5)

[Back to BioLiP]