Structure of PDB 4un8 Chain G Binding Site BS01

Receptor Information
>4un8 Chain G (length=177) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4un8 Visualizing Phosphodiester-Bond Hydrolysis by an Endonuclease.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
K86 Y89 N93
Binding residue
(residue number reindexed from 1)
K82 Y85 N89
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4un8, PDBe:4un8, PDBj:4un8
PDBsum4un8
PubMed25486305
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]