Structure of PDB 4r6o Chain G Binding Site BS01

Receptor Information
>4r6o Chain G (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>4r6o Chain D (length=14) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGISQTVIVGPWGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r6o Jacalin-carbohydrate interactions: distortion of the ligand molecule as a determinant of affinity.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
T10 F60 P61 Y64 L112 L133
Binding residue
(residue number reindexed from 1)
T10 F60 P61 Y64 L112 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4r6o, PDBe:4r6o, PDBj:4r6o
PDBsum4r6o
PubMed25664742
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]