Structure of PDB 4pv1 Chain G Binding Site BS01

Receptor Information
>4pv1 Chain G (length=37) Species: 83541 (Mastigocladus laminosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG
Ligand information
>4pv1 Chain H (length=28) Species: 83541 (Mastigocladus laminosus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIDVLGWVALLVVFTWSIAMVVWGRNGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pv1 Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L5 Q27
Binding residue
(residue number reindexed from 1)		L5 Q27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0015979 photosynthesis
GO:0017004 cytochrome complex assembly
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pv1, PDBe:4pv1, PDBj:4pv1
PDBsum4pv1
PubMed25296314
UniProtP83797|PETG_MASLA Cytochrome b6-f complex subunit 5 (Gene Name=petG)

[Back to BioLiP]