Structure of PDB 4nnd Chain G Binding Site BS01

Receptor Information
>4nnd Chain G (length=278) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSARSFLERLVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYKD
VLPYDQTRVILSLLQEEHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDF
WRLVWEFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEK
WLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSPDHMLAMVEEARR
LQGSGPEPLCVHSSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLK
MRKQRPAAVQTEEQYRFLYHTVAQMFCS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nnd Large-scale structural analysis of the classical human protein tyrosine phosphatome.
Resolution2.502 Å
Binding residue
(original residue number in PDB)		Y62 D64 R138 D197 S229 S230 A231 C233 R235 Q276
Binding residue
(residue number reindexed from 1)		Y48 D50 R123 D182 S213 S214 A215 C217 R219 Q260
Enzymatic activity
Catalytic site (original residue number in PDB) D197 S229 R235 T236 Q276
Catalytic site (residue number reindexed from 1) D182 S213 R219 T220 Q260
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
GO:0004726 non-membrane spanning protein tyrosine phosphatase activity
Biological Process
GO:0006470 protein dephosphorylation
GO:0016311 dephosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4nnd, PDBe:4nnd, PDBj:4nnd
PDBsum4nnd
PubMed
UniProtQ99952|PTN18_HUMAN Tyrosine-protein phosphatase non-receptor type 18 (Gene Name=PTPN18)

[Back to BioLiP]