Structure of PDB 4kud Chain G Binding Site BS01

Receptor Information

>4kud Chain G (length=105) Species: 559292 (Saccharomyces cerevisiae S288C)

SQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEIL
ELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQ
NLLPK

Ligand information

>4kud Chain I (length=146)

atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4kud N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain.
• Resolution: 3.203 Å
• Binding residue (original residue number in PDB): S15 R30 R43 S46 K76 T77 R78
• Binding residue (residue number reindexed from 1): S1 R16 R29 S32 K62 T63 R64
• Binding affinity: PDBbind-CN: Kd=0.04uM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006281 DNA repair
• GO:0006325 chromatin organization
• GO:0031507 heterochromatin formation

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0031298 replication fork protection complex
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:4kud, PDBe:4kud, PDBj:4kud
• PDBsum: 4kud
• PubMed: 23934152
• UniProt: P04912|H2A2_YEAST Histone H2A.2 (Gene Name=HTA2)