Structure of PDB 4gha Chain G Binding Site BS01

Receptor Information
>4gha Chain G (length=122) Species: 33727 (Marburg virus - Musoke, Kenya, 1980) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILS
EGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNP
TIDKGWVCVYSSEQGETRALKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gha Marburg Virus VP35 Can Both Fully Coat the Backbone and Cap the Ends of dsRNA for Interferon Antagonism.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
T226 P295
Binding residue
(residue number reindexed from 1)
T19 P88
Binding affinityPDBbind-CN: Kd=0.5uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4gha, PDBe:4gha, PDBj:4gha
PDBsum4gha
PubMed23028316
UniProtP35259|VP35_MABVM Polymerase cofactor VP35 (Gene Name=VP35)

[Back to BioLiP]