Structure of PDB 4gcl Chain G Binding Site BS01

Receptor Information

>4gcl Chain G (length=190) Species: 364106 (Escherichia coli UTI89) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRM
FDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRI
LTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLL
ASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ

Ligand information

>4gcl Chain R (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agtgagtactcact

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4gcl SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	R11 S44 A46 A47 R50 H51
Binding residue (residue number reindexed from 1)	R3 S36 A38 A39 R42 H43
Binding affinity	PDBbind-CN: Kd=156.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0010974	negative regulation of division septum assembly
GO:0051301	cell division
GO:0051302	regulation of cell division

	Cellular Component
GO:0005737	cytoplasm
GO:0009295	nucleoid
GO:0043590	bacterial nucleoid

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4gcl, PDBe:4gcl, PDBj:4gcl
PDBsum	4gcl
PubMed	23754405
UniProt	Q1R4V1

[Back to BioLiP]