Structure of PDB 4cc3 Chain G Binding Site BS01

Receptor Information
>4cc3 Chain G (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGY
VPSNYIRKTEY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cc3 Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		Y1522 R1527 N1530 D1547 V1548 W1554 Y1565 P1567 N1569 Y1570 Y1576
Binding residue
(residue number reindexed from 1)		Y7 R12 N15 D32 V33 W39 Y50 P52 N54 Y55 Y61
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4cc3, PDBe:4cc3, PDBj:4cc3
PDBsum4cc3
PubMed24332715
UniProtQ6XZF7|DNMBP_HUMAN Dynamin-binding protein (Gene Name=DNMBP)

[Back to BioLiP]