Structure of PDB 4bqa Chain G Binding Site BS01

Receptor Information
>4bqa Chain G (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKP
KMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bqa Structural Insights Into the Autoregulation and Cooperativity of the Human Transcription Factor Ets-2.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y414 R419 R422 Y423 Y425 K432 R437 Y438
Binding residue
(residue number reindexed from 1)		Y54 R59 R62 Y63 Y65 K72 R77 Y78
Binding affinityPDBbind-CN: Kd=0.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4bqa, PDBe:4bqa, PDBj:4bqa
PDBsum4bqa
PubMed25670864
UniProtP15036|ETS2_HUMAN Protein C-ets-2 (Gene Name=ETS2)

[Back to BioLiP]