Structure of PDB 4asu Chain G Binding Site BS01

Receptor Information

>4asu Chain G (length=181) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGLII
GVSSDRGLCGAIHSSVAIIGVGDKIRSILTFKEVGRRPPTFGDASVIALE
LSIIFNRFRSVISYKTEYSLANIIYYSLKESTTSEQSARMTAMDNASKNA
SEMIDKLTLTFNRTRQAVITKELIEIISGAA

Ligand information

>4asu Chain I (length=23) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SYIRYSQICAKAVRDATIKIVKV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4asu Structural Evidence of a New Catalytic Intermediate in the Pathway of ATP Hydrolysis by F1-ATPase from Bovine Heart Mitochondria.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	T127 F128 K129 E130 D140 L146 Y207
Binding residue (residue number reindexed from 1)	T80 F81 K82 E83 D93 L99 Y118

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism

	Biological Process
GO:0006754	ATP biosynthetic process
GO:0015986	proton motive force-driven ATP synthesis
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0045259	proton-transporting ATP synthase complex
GO:0045261	proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4asu, PDBe:4asu, PDBj:4asu
PDBsum	4asu
PubMed	22733764
UniProt	P05631\|ATPG_BOVIN ATP synthase subunit gamma, mitochondrial (Gene Name=ATP5F1C)

[Back to BioLiP]