Structure of PDB 4a76 Chain G Binding Site BS01

Receptor Information

>4a76 Chain G (length=88) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYME
GFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN

Ligand information

>4a76 Chain B (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4a76 The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
Resolution	1.92 Å
Binding residue (original residue number in PDB)	V42 R43 G45 Q69 F77 R78
Binding residue (residue number reindexed from 1)	V17 R18 G20 Q44 F52 R53
Binding affinity	PDBbind-CN: Kd=59nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding

View graph for
Molecular Function

External links

PDB	RCSB:4a76, PDBe:4a76, PDBj:4a76
PDBsum	4a76
PubMed	22570413
UniProt	B4F6I0

[Back to BioLiP]