Structure of PDB 4a75 Chain G Binding Site BS01

Receptor Information
>4a75 Chain G (length=88) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYME
GFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a75 The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		K38 W39 N41 V42 M44 G45 F46 F48 D64 F66 H68 Q69 F77 R78 K95 F97
Binding residue
(residue number reindexed from 1)		K13 W14 N16 V17 M19 G20 F21 F23 D39 F41 H43 Q44 F52 R53 K70 F72
Binding affinityPDBbind-CN: Kd=169nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4a75, PDBe:4a75, PDBj:4a75
PDBsum4a75
PubMed22570413
UniProtB4F6I0

[Back to BioLiP]