Structure of PDB 3zla Chain G Binding Site BS01

Receptor Information
>3zla Chain G (length=229) Species: 35304 (Bunyamwera virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMIELEFHDVATFDPEVAYANFKRVHTTGLSYDHIRIFYIKGREIKTSL
AKRSEWEVTLNLGGWKITVYNTNFPGNRNNPVPDDGLTLHRLSGFLARYL
LEKMLKVSEPEKLIIKSKIINPLAEKNGITWNDGEEVYLSFFPGSEMFLG
TFRFYPLAIGIYKVQRKEMEPKYLEKTMRQRYMGLEAATWTVSKLTEVQS
ALTVVSSLGWKKTNVSAAARDFLAKFGIN
Ligand information
>3zla Chain J (length=44) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zla Nucleocapsid Protein Structures from Orthobunyaviruses Reveal Insight Into Ribonucleoprotein Architecture and RNA Polymerization.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		T16 F17 R47 K50 T75 R81 T91 R94 I123 P125 L126 E128 K129 Y176 K179 R182 R184 E189 A190 N217
Binding residue
(residue number reindexed from 1)		T13 F14 R44 K47 T72 R78 T88 R91 I120 P122 L123 E125 K126 Y173 K176 R179 R181 E186 A187 N214
Binding affinityPDBbind-CN: Kd=62.9nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0039657 symbiont-mediated suppression of host gene expression
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019029 helical viral capsid
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3zla, PDBe:3zla, PDBj:3zla
PDBsum3zla
PubMed23595147
UniProtP16495|NCAP_BUNYW Nucleoprotein (Gene Name=N)

[Back to BioLiP]