Structure of PDB 3tmh Chain G Binding Site BS01

Receptor Information
>3tmh Chain G (length=33) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRL
Ligand information
>3tmh Chain H (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KMIVSDVMQQAQYDQPLEKSTKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tmh Differential mode of D-AKAP2 to PKA isoforms: Insights from D-AKAP2 PKA RII PDZK1 ternary complex structure
Resolution3.8 Å
Binding residue
(original residue number in PDB)		T10 Q14
Binding residue
(residue number reindexed from 1)		T4 Q8
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tmh, PDBe:3tmh, PDBj:3tmh
PDBsum3tmh
PubMed
UniProtP12368|KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit (Gene Name=Prkar2a)

[Back to BioLiP]