Structure of PDB 3sl9 Chain G Binding Site BS01

Receptor Information
>3sl9 Chain G (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSA
IVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSP
VDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAIT
TDCLQILA
Ligand information
>3sl9 Chain D (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SQEQLEHRERSLQTLRDIQRMLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3sl9 An intrinsically labile alpha-helix abutting the BCL9-binding site of beta-catenin is required for its inhibition by carnosic acid.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N204 T205 K242
Binding residue
(residue number reindexed from 1)		N57 T58 K95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0045296 cadherin binding
Biological Process
GO:0007155 cell adhesion

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3sl9, PDBe:3sl9, PDBj:3sl9
PDBsum3sl9
PubMed22353711
UniProtP35222|CTNB1_HUMAN Catenin beta-1 (Gene Name=CTNNB1)

[Back to BioLiP]