Structure of PDB 3lrh Chain G Binding Site BS01

Receptor Information
>3lrh Chain G (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYD
DDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVF
GGGTKVTVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lrh A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		I37 L47 Y50 Y88 W99 F101
Binding residue
(residue number reindexed from 1)		I36 L46 Y49 Y87 W98 F100
External links