Structure of PDB 3lm1 Chain G Binding Site BS01

Receptor Information
>3lm1 Chain G (length=133) Species: 3496 (Maclura pomifera) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITG
FKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTN
GTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lm1 Characterization of the secondary binding sites of Maclura pomifera agglutinin by glycan array and crystallographic analyses.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T10 F60 P61 Y64 L112 L133
Binding residue
(residue number reindexed from 1)		T10 F60 P61 Y64 L112 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030246 carbohydrate binding

View graph for
Molecular Function
External links
PDB RCSB:3lm1, PDBe:3lm1, PDBj:3lm1
PDBsum3lm1
PubMed20826825
UniProtP18674|LECA_MACPO Agglutinin alpha chain

[Back to BioLiP]