Structure of PDB 3kl8 Chain G Binding Site BS01

Receptor Information

>3kl8 Chain G (length=259) Species: 6239 (Caenorhabditis elegans)

TKFSDNYDVKEESVVRRCVHKTTGLEFAAKIINTSARDFQKLEREARICR
KLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHC
IQQILESIAYCHSNGIVHRNLKPENLLLASKAKGAAVKLADFGLAIEVND
SEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDE
DQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQAL
KVPWICNRE

Ligand information

>3kl8 Chain F (length=17) Species: 10116 (Rattus norvegicus)

KRPPKLGQIGRSKRVVI

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3kl8 Intersubunit capture of regulatory segments is a component of cooperative CaMKII activation.
• Resolution: 3.372 Å
• Binding residue (original residue number in PDB): E96 F98 N135 E139 D156 F172 A173 G174 P176 G208 P210 P211 W213 Y229 D230 P232 S233 E235
• Binding residue (residue number reindexed from 1): E81 F83 N120 E124 D141 F157 A158 G159 P161 G193 P195 P196 W198 Y214 D215 P217 S218 E220

Enzymatic activity

• Catalytic site (original residue number in PDB): N135 K137 E139 N140 D156 T175
• Catalytic site (residue number reindexed from 1): N120 K122 E124 N125 D141 T160
• Enzyme Commision number: 2.7.11.17: calcium/calmodulin-dependent protein kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:3kl8, PDBe:3kl8, PDBj:3kl8
• PDBsum: 3kl8
• PubMed: 20139983
• UniProt: O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II (Gene Name=unc-43)