Structure of PDB 3kl8 Chain G Binding Site BS01

Receptor Information
>3kl8 Chain G (length=259) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKFSDNYDVKEESVVRRCVHKTTGLEFAAKIINTSARDFQKLEREARICR
KLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHC
IQQILESIAYCHSNGIVHRNLKPENLLLASKAKGAAVKLADFGLAIEVND
SEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDE
DQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQAL
KVPWICNRE
Ligand information
>3kl8 Chain F (length=17) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRPPKLGQIGRSKRVVI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kl8 Intersubunit capture of regulatory segments is a component of cooperative CaMKII activation.
Resolution3.372 Å
Binding residue
(original residue number in PDB)
E96 F98 N135 E139 D156 F172 A173 G174 P176 G208 P210 P211 W213 Y229 D230 P232 S233 E235
Binding residue
(residue number reindexed from 1)
E81 F83 N120 E124 D141 F157 A158 G159 P161 G193 P195 P196 W198 Y214 D215 P217 S218 E220
Enzymatic activity
Catalytic site (original residue number in PDB) N135 K137 E139 N140 D156 T175
Catalytic site (residue number reindexed from 1) N120 K122 E124 N125 D141 T160
Enzyme Commision number 2.7.11.17: calcium/calmodulin-dependent protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3kl8, PDBe:3kl8, PDBj:3kl8
PDBsum3kl8
PubMed20139983
UniProtO62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II (Gene Name=unc-43)

[Back to BioLiP]