Structure of PDB 3bim Chain G Binding Site BS01

Receptor Information
>3bim Chain G (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGL
FYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVM
ATAMYLQMEHVVDTCRKFIKAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bim Structure of a BCOR corepressor peptide in complex with the BCL6 BTB domain dimer.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
M51 A52 G55 Y58 E115 H116
Binding residue
(residue number reindexed from 1)
M45 A46 G49 Y52 E109 H110
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3bim, PDBe:3bim, PDBj:3bim
PDBsum3bim
PubMed18280243
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]