Structure of PDB 3ax2 Chain G Binding Site BS01

Receptor Information
>3ax2 Chain G (length=66) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVL
QQTLPPPVFQMLLTKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ax2 Crystallographic snapshots of tom20-mitochondrial presequence interactions with disulfide-stabilized peptides.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K61 D62 Q67 K68 F70 L71 C100 Q105 L106
Binding residue
(residue number reindexed from 1)		K1 D2 Q7 K8 F10 L11 C40 Q45 L46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ax2, PDBe:3ax2, PDBj:3ax2
PDBsum3ax2
PubMed21591667
UniProtQ62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)

[Back to BioLiP]