Structure of PDB 2zvw Chain G Binding Site BS01

Receptor Information
>2zvw Chain G (length=255) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLELRLVQGSLLKKVLEAVKDLVNDANFDCSTTGFSLQAMDSSHVALVSL
LLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVT
FMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSGEFSRICKD
LSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMN
EPVSLSFALRYMNSFTKATPLSETVTISLSSELPVVVEYKVAEMGYIRYY
LAPKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zvw Crystal structures of the Arabidopsis thaliana proliferating cell nuclear antigen 1 and 2 proteins complexed with the human p21 C-terminal segment
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H44 V45 H125 L126 G127 P234 Y250 A252 P253 K254 I255
Binding residue
(residue number reindexed from 1)		H44 V45 H125 L126 G127 P234 Y250 A252 P253 K254 I255
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006275 regulation of DNA replication
GO:0042276 error-prone translesion synthesis
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zvw, PDBe:2zvw, PDBj:2zvw
PDBsum2zvw
PubMed19388052
UniProtQ9ZW35|PCNA2_ARATH Proliferating cell nuclear antigen 2 (Gene Name=PCNA2)

[Back to BioLiP]