Structure of PDB 2z3f Chain G Binding Site BS01

Receptor Information
>2z3f Chain G (length=160) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQ
SYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQLSDVLGVTVILLSCA
YEDNEFVRVGYYVNNEMEGLNLQEMDDAEIKKVKVDISKVWRSILAEKPR
VTRFNIQWDN
Ligand information
>2z3f Chain O (length=10) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRIAPTPVYP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z3f Crystal Structures of Fission Yeast Histone Chaperone Asf1 Complexed with the Hip1 B-domain or the Cac2 C Terminus
Resolution2.7 Å
Binding residue
(original residue number in PDB)		D37 L61 G63 P64 I69 N70 K71
Binding residue
(residue number reindexed from 1)		D36 L60 G62 P63 I68 N69 K70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2z3f, PDBe:2z3f, PDBj:2z3f
PDBsum2z3f
PubMed18334479
UniProtO74515|ASF1_SCHPO Histone chaperone cia1 (Gene Name=cia1)

[Back to BioLiP]