Structure of PDB 2y9h Chain G Binding Site BS01

Receptor Information
>2y9h Chain G (length=199) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLE
PPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPA
KRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFL
EVRRKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y9h An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y23 R43 K105 R106 A108 K112 R113 R128 R129 V156 R157 Q170 V171 R194 K200 L202
Binding residue
(residue number reindexed from 1)		Y24 R44 K101 R102 A104 K108 R109 R124 R125 V152 R153 Q158 V159 R182 K188 L190
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2y9h, PDBe:2y9h, PDBj:2y9h
PDBsum2y9h
PubMed21572442
UniProtQ53WG9|CAS6_THET8 CRISPR-associated endoribonuclease Cse3 (Gene Name=cse3)

[Back to BioLiP]