Structure of PDB 2p1l Chain G Binding Site BS01

Receptor Information
>2p1l Chain G (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSD
LTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDK
EMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNN
Ligand information
>2p1l Chain H (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSGTMENLSRRLKVTGDLFDIMSG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2p1l Crystal structure of the Bcl-XL-Beclin 1 peptide complex: Beclin 1 is a novel BH3-only protein
Resolution2.5 Å
Binding residue
(original residue number in PDB)		E96 F97 R100 Y101 F105 Q111 L112 Q125 V126 E129 L130 D133 N136 G138 R139 Y195
Binding residue
(residue number reindexed from 1)		E39 F40 R43 Y44 F48 Q54 L55 Q68 V69 E72 L73 D76 N79 G81 R82 Y138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2p1l, PDBe:2p1l, PDBj:2p1l
PDBsum2p1l
PubMed17337444
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]