Structure of PDB 2oqj Chain G Binding Site BS01

Receptor Information

>2oqj Chain G (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VVMTQSPSTLSASVGDTITITCRASQSIETWLAWYQQKPGKAPKLLIYKA
STLKTGVPSRFSGSGSGTEFTLTISGLQFDDFATYHCQHYAGYSATFGQG
TRVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD
NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRG

Ligand information

>2oqj Chain I (length=17) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ACPPSHVLDMRSGTCLA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2oqj A peptide inhibitor of HIV-1 neutralizing antibody 2G12 is not a structural mimic of the natural carbohydrate epitope on gp120.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	W32 H90
Binding residue (residue number reindexed from 1)	W31 H89

External links

PDB	RCSB:2oqj, PDBe:2oqj, PDBj:2oqj
PDBsum	2oqj
PubMed	18198210

[Back to BioLiP]