Structure of PDB 2jdi Chain G Binding Site BS01

Receptor Information
>2jdi Chain G (length=184) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGLII
GVSSDRGLCGAIHSSVAIIGVGDKIRSILTFKEVGRRPPTFGDASVIALE
LSIIFNRFRSVISYKTEYSLANIIYYSLKESTTSEQSARMTAMDNASKNA
SEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
Ligand information
>2jdi Chain I (length=25) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VAYWRQAGLSYIRYSQICAKAVRDA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jdi Ground State Structure of F1-ATPase from Bovine Heart Mitochondria at 1.9 A Resolution
Resolution1.9 Å
Binding residue
(original residue number in PDB)		L146 Y207
Binding residue
(residue number reindexed from 1)		L99 Y118
Enzymatic activity
Enzyme Commision number 3.6.1.34: Transferred entry: 7.1.2.2.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045259 proton-transporting ATP synthase complex
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2jdi, PDBe:2jdi, PDBj:2jdi
PDBsum2jdi
PubMed17350959
UniProtP05631|ATPG_BOVIN ATP synthase subunit gamma, mitochondrial (Gene Name=ATP5F1C)

[Back to BioLiP]