Structure of PDB 2f8n Chain G Binding Site BS01

Receptor Information
>2f8n Chain G (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAE
ILELAVNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNI
HPELLAKK
Ligand information
>2f8n Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaatccgctgaacatgccttttgatggagc
agtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2f8n Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K1014 R1029 K1035 R1042 G1044 K1075 R1077
Binding residue
(residue number reindexed from 1)		K3 R18 K24 R31 G33 K64 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2f8n, PDBe:2f8n, PDBj:2f8n
PDBsum2f8n
PubMed
UniProtO75367|H2AY_HUMAN Core histone macro-H2A.1 (Gene Name=MACROH2A1)

[Back to BioLiP]