Structure of PDB 1zvv Chain G Binding Site BS01

Receptor Information
>1zvv Chain G (length=329) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNVTIYDVAREASVSMATVSRVVNGNPNVKPSTRKKVLETIEYRPNAVAR
GLASKKTTTVGVIIPDISNIFYAELARGIEDIASMYKYNIILSNSDQNQD
KQLHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQ
IPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRA
LTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALG
VIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMR
LLTKYMNKETVDSSIVELPHRIEFRQSTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zvv Phosphoprotein Crh-Ser46-P displays altered binding to CcpA to effect carbon catabolite regulation.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		S15 T18 R21 N28 T33 L55 A56 K58
Binding residue
(residue number reindexed from 1)		S15 T18 R21 N28 T33 L52 A53 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zvv, PDBe:1zvv, PDBj:1zvv
PDBsum1zvv
PubMed16316990
UniProtP25144|CCPA_BACSU Catabolite control protein A (Gene Name=ccpA)

[Back to BioLiP]