Structure of PDB 1u35 Chain G Binding Site BS01

Receptor Information
>1u35 Chain G (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEIL
ELAVNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHP
ELLAKK
Ligand information
>1u35 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaatccgctgaacatgccttttgatggagc
agtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u35 Structural characterization of the histone variant macroH2A.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K1014 R1029 R1042 I1043 G1044 V1045 K1075 G1076 R1077
Binding residue
(residue number reindexed from 1)		K1 R16 R29 I30 G31 V32 K62 G63 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1u35, PDBe:1u35, PDBj:1u35
PDBsum1u35
PubMed16107708
UniProtO75367|H2AY_HUMAN Core histone macro-H2A.1 (Gene Name=MACROH2A1)

[Back to BioLiP]