Structure of PDB 1trr Chain G Binding Site BS01

Receptor Information
>1trr Chain G (length=104) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQQSPYSAAMAEQRHEEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREAL
GTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLE
EVLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1trr Tandem binding in crystals of a trp repressor/operator half-site complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		A2 Q3 R15 T44 Q68 R69 I79 T83 S86 N87 K90
Binding residue
(residue number reindexed from 1)		A1 Q2 R14 T43 Q67 R68 I78 T82 S85 N86 K89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1trr, PDBe:1trr, PDBj:1trr
PDBsum1trr
PubMed8232559
UniProtP0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)

[Back to BioLiP]