Structure of PDB 1s03 Chain G Binding Site BS01

Receptor Information
>1s03 Chain G (length=126) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGD
TKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVV
STSKGVMTDRAARQAGLGGEIICYVA
Ligand information
>1s03 Chain B (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacgauggcgaaacugcaugaggcaauucaugcaagucccucgucc
<<<<<<.<<.<<..<<<<<<<<......>>>>>>.>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s03 The structure of a ribosomal protein S8/spc operon mRNA complex.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		P5 S29 K30 R83 Y85 R87 K88 S104 T105 S106 K107 G119 G121
Binding residue
(residue number reindexed from 1)		P2 S26 K27 R80 Y82 R84 K85 S101 T102 S103 K104 G116 G118
Binding affinityPDBbind-CN: Kd=0.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043488 regulation of mRNA stability
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s03, PDBe:1s03, PDBj:1s03
PDBsum1s03
PubMed15146079
UniProtP0A7W7|RS8_ECOLI Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]