Structure of PDB 1p3o Chain G Binding Site BS01

Receptor Information
>1p3o Chain G (length=106) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPKK
Ligand information
>1p3o Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p3o Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
Resolution2.75 Å
Binding residue
(original residue number in PDB)		R1029 R1035 R1042 G1044 K1075 T1076 R1077
Binding residue
(residue number reindexed from 1)		R16 R22 R29 G31 K62 T63 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1p3o, PDBe:1p3o, PDBj:1p3o
PDBsum1p3o
PubMed14739929
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]