Structure of PDB 1n3e Chain G Binding Site BS01

Receptor Information
>1n3e Chain G (length=151) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQRR
WFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQA
NLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVL
D
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1n3e Flexible DNA Target Site Recognition by Divergent Homing Endonuclease Isoschizomers I-CreI and I-MsoI
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D520 T546 Q547 K548
Binding residue
(residue number reindexed from 1)		D18 T44 Q45 K46
Enzymatic activity
Catalytic site (original residue number in PDB) G519 D520
Catalytic site (residue number reindexed from 1) G17 D18
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n3e, PDBe:1n3e, PDBj:1n3e
PDBsum1n3e
PubMed12758074
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]