Structure of PDB 1m19 Chain G Binding Site BS01

Receptor Information
>1m19 Chain G (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSV
LLPKK
Ligand information
>1m19 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m19 Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R1029 R1042 V1043 G1044 A1045 K1075 T1076 R1077
Binding residue
(residue number reindexed from 1)		R15 R28 V29 G30 A31 K61 T62 R63
Binding affinityPDBbind-CN: Kd=0.6uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m19, PDBe:1m19, PDBj:1m19
PDBsum1m19
PubMed12559907
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]