Structure of PDB 1lq8 Chain G Binding Site BS01

Receptor Information
>1lq8 Chain G (length=330) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRDFTFDLYRALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTKMQILEG
LGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDT
FVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSN
AVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHY
LLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMF
KKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQV
SEMVHKAVVEVDESGTRAAAATGTIFTFRS
Ligand information
>1lq8 Chain H (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NSQRLVFNRPFLMFIVDNNILFLGKVNRP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lq8 Crystal Structure of Protein C Inhibitor Provides Insights into Hormone Binding and Heparin Activation
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T30 F31 Y34 S43 Q44 N45 I46 F47 F48 S49 P50 V51 L108 I184 F186 F204 Y205 V206 E220 V236 A244 T245 A246 L247 F248 I249 L250 E253 M256 E260 L268 Q279 L280 E281 Y283 P285 F287 I289 A343 A344
Binding residue
(residue number reindexed from 1)		T5 F6 Y9 S18 Q19 N20 I21 F22 F23 S24 P25 V26 L83 I159 F161 F179 Y180 V181 E195 V211 A219 T220 A221 L222 F223 I224 L225 E228 M231 E235 L243 Q254 L255 E256 Y258 P260 F262 I264 A318 A319
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Cellular Component
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1lq8, PDBe:1lq8, PDBj:1lq8
PDBsum1lq8
PubMed12575940
UniProtP05154|IPSP_HUMAN Plasma serine protease inhibitor (Gene Name=SERPINA5)

[Back to BioLiP]