Structure of PDB 1kx4 Chain G Binding Site BS01

Receptor Information
>1kx4 Chain G (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPK
Ligand information
>1kx4 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctccaaatatcccttgcggatcgtagaaaaagtgtgtcaaactgcgct
atcaaagggaaacttcaactgaattcagttgaagtttccctttgatagcg
cagtttgacacactttttctacgatccgcaagggatatttggagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kx4 Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R29 R42 G44 A45 K75
Binding residue
(residue number reindexed from 1)		R16 R29 G31 A32 K62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1kx4, PDBe:1kx4, PDBj:1kx4
PDBsum1kx4
PubMed12079350
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]