Structure of PDB 1kuj Chain G Binding Site BS01

Receptor Information
>1kuj Chain G (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>1kuj Chain D (length=16) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QSGISQTVIVGPWGAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kuj Structural basis for the unusual carbohydrate-binding specificity of jacalin towards galactose and mannose.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T10 P61 G111 L112 L133
Binding residue
(residue number reindexed from 1)		T10 P61 G111 L112 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kuj, PDBe:1kuj, PDBj:1kuj
PDBsum1kuj
PubMed11988090
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]