Structure of PDB 1hwt Chain G Binding Site BS01

Receptor Information
>1hwt Chain G (length=70) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKEL
LKDNELKKLRERVKSLEKTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hwt Structure of a HAP1-DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D111 L114 R118
Binding residue
(residue number reindexed from 1)		D53 L56 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hwt, PDBe:1hwt, PDBj:1hwt
PDBsum1hwt
PubMed9886294
UniProtP0CS82|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 (Gene Name=HAP1)

[Back to BioLiP]