Structure of PDB 1hbx Chain G Binding Site BS01

Receptor Information
>1hbx Chain G (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNK
PNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMSRNDYIHS
GLYSSFTLNSLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hbx The B-Box Dominates Sap-1/Srf Interactions in the Structure of the Ternary Complex
Resolution3.15 Å
Binding residue
(original residue number in PDB)		T6 W45 K49 K51 M54 K58 Y66 N139
Binding residue
(residue number reindexed from 1)		T5 W44 K48 K50 M53 K57 Y65 N95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hbx, PDBe:1hbx, PDBj:1hbx
PDBsum1hbx
PubMed11406578
UniProtP28324|ELK4_HUMAN ETS domain-containing protein Elk-4 (Gene Name=ELK4)

[Back to BioLiP]