Structure of PDB 1gd2 Chain G Binding Site BS01

Receptor Information
>1gd2 Chain G (length=64) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEPSSKRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQL
RQKVRQLEEELRIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gd2 Structural basis for the diversity of DNA recognition by bZIP transcription factors.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		P78 K83 N86 R87 Q90 R94
Binding residue
(residue number reindexed from 1)		P3 K8 N11 R12 Q15 R19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gd2, PDBe:1gd2, PDBj:1gd2
PDBsum1gd2
PubMed11017199
UniProtQ01663|AP1_SCHPO AP-1-like transcription factor (Gene Name=pap1)

[Back to BioLiP]