Structure of PDB 1f2i Chain G Binding Site BS01

Receptor Information
>1f2i Chain G (length=66) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLLNYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMR
NFSRSDHLTTHIRTHT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f2i Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		R1103 F1116 R1118 E1121 R1124 H1125 I1128 S1145 R1146 H1149
Binding residue
(residue number reindexed from 1)		R11 F24 R26 E29 R32 H33 I36 S53 R54 H57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1f2i, PDBe:1f2i, PDBj:1f2i
PDBsum1f2i
PubMed11427887
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]