Structure of PDB 1eqz Chain G Binding Site BS01

Receptor Information
>1eqz Chain G (length=120) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL
PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK
RVTIMPKDIQLARRIRGERA
Ligand information
>1eqz Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eqz Asymmetries in the nucleosome core particle at 2.5 A resolution.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		A24 R40 Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83
Binding residue
(residue number reindexed from 1)		A9 R25 Y26 G29 V31 A32 R34 R48 K49 L50 P51 R54 R68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0010467 gene expression
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1eqz, PDBe:1eqz, PDBj:1eqz
PDBsum1eqz
PubMed11092917
UniProtP84229|H32_CHICK Histone H3.2 (Gene Name=H3-I)

[Back to BioLiP]