Structure of PDB 6sga Chain FS Binding Site BS01

Receptor Information
>6sga Chain FS (length=277) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASDRAVINAGGRRFETLFSTLHRYPDTPFAQLFPLPGRGARQHRGREFFL
DVTPHVFEYILGFLRTNQLNLPAENLQIRAEVVYSMNQWGLLEHAFPPEV
IAVVKLPDVCVVQVCDHMQHDQGVKRHALTITYGADGFQLRSLIRRVRRD
LERQLSSTYWQCYQTNERAAFFVTTKVANGTADLLTTSVTQQLVEHTESM
GYSLASSYVTLSPDVVHTSVRMLIHNFTFRRSRRVSETIEAEPNIPTMHV
GPRREPLNAAESIPPRNERAVNIWTVD
Ligand information
>6sga Chain FF (length=16) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MKRIVVPHRWSEMNRV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sga Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R166 E169 S266 E267 T268 I269 E270 E272
Binding residue
(residue number reindexed from 1)		R149 E152 S236 E237 T238 I239 E240 E242
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005249 voltage-gated potassium channel activity
GO:0015272 ATP-activated inward rectifier potassium channel activity
Biological Process
GO:0006813 potassium ion transport
GO:0051260 protein homooligomerization
GO:0071805 potassium ion transmembrane transport
GO:0098655 monoatomic cation transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0008076 voltage-gated potassium channel complex
GO:0016020 membrane
GO:0097014 ciliary plasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sga, PDBe:6sga, PDBj:6sga
PDBsum6sga
PubMed31515389
UniProtQ387P8

[Back to BioLiP]