Structure of PDB 6sgb Chain FM Binding Site BS01

Receptor Information
>6sgb Chain FM (length=326) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIKRSLNVGVVGMGNMGVPIARNLGFKARSAMYLQIHSRALSKAKRVCDD
LSVDGATCAMRIHDRYSTMTKWCDVIVLALADVKASRHALLEDNESLIMN
ARKGQIIVDHTTVDAETSRECAHEAARRGAYFLDAPMSGSPRACFNGQLL
LMVGGDAETFQKMLPIFHMYADNVFHMGESGSGTAAKMISQALVASHNAA
AAEALSMAHALGIEDQSKLVQVLDASWGSSTMLRRNAPLLQDLIRNPDKT
PPTSAVSVDRLLSDLAHLDASLPKRGGEDEPFPVFDAALRSLAAASDAGM
GDRDLASVVHYIEAGEAELRNRTHVP
Ligand information
>6sgb Chain UQ (length=9) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sgb Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		D271 D281 E282 F284 D288 A295 E320 R324
Binding residue
(residue number reindexed from 1)		D269 D279 E280 F282 D286 A293 E318 R322
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 09:21:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6sgb', asym_id = 'FM', bs = 'BS01', title = 'Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6sgb', asym_id='FM', bs='BS01', title='Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0050661,0051287', uniprot = '', pdbid = '6sgb', asym_id = 'FM'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0050661,0051287', uniprot='', pdbid='6sgb', asym_id='FM')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>